PDB entry 6gth

View 6gth on RCSB PDB site
Description: Serial Femtosecond Crystallography at Megahertz pulse rates
Class: antibiotic
Keywords: Ser-beta-lactamase, inhibitor, complex, avibactam, ANTIBIOTIC
Deposited on 2018-06-18, released 2018-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: CTX-M-14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6gtha_
  • Heterogens: NXL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6gthA (A:)
savqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetq
kqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
vtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraql
vtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpq
qnaesrrdvlasaariiaeg