PDB entry 6gt7

View 6gt7 on RCSB PDB site
Description: nmr structure of the free helix bundle domain from the functional prn1 primase
Deposited on 2018-06-15, released 2018-12-26
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: functional pRN1 primase
    Species: Sulfolobus islandicus [TaxId:43080]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gt7A (A:)
    tvvefeelrkelvkrdsgkpvekikeeictksppklikeiicenktyadvnidrsrgdwh
    vilylmkhgvtdpdkilellprdskakenekwntqkyfvitlskawsvvkkylea