PDB entry 6gt6

View 6gt6 on RCSB PDB site
Description: Crystal structure of recombinant coagulation factor beta-XIIa
Class: blood clotting
Keywords: human coagulation factor XIIa, hydrolase, serine protease, BLOOD CLOTTING
Deposited on 2018-06-15, released 2019-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Coagulation factor XII
    Species: Homo sapiens [TaxId:9606]
    Gene: F12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00748 (0-242)
      • expression tag (243-244)
    Domains in SCOPe 2.07: d6gt6b1, d6gt6b2
  • Heterogens: NAG, MAN, GOL, SO4, CYS, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gt6B (B:)
    vvgglvalrgahpyiaalywghsfcagsliapcwvltaahclqdrpapedltvvlgqerr
    nhscepcqtlavrsyrlheafspvsyqhdlallrlqedadgscallspyvqpvclpsgaa
    rpsettlcqvagwghqfegaeeyasflqeaqvpflslercsapdvhgssilpgmlcagfl
    eggtdacqgdsggplvcedqaaerrltlqgiiswgsgcgdrnkpgvytdvayylawireh
    tvstrtghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gt6B (B:)
    vvgglvalrgahpyiaalywghsfcagsliapcwvltaahclqdrpapedltvvlgqerr
    nhscepcqtlavrsyrlheafspvsyqhdlallrlqedadgscallspyvqpvclpsgap
    settlcqvagwghqfegaeeyasflqeaqvpflslercsapdvhgssilpgmlcagfleg
    gtdacqgdsggplvcedrltlqgiiswgsgcgdrnkpgvytdvayylawirehtvstr