PDB entry 6gsv

View 6gsv on RCSB PDB site
Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Class: transferase
Keywords: glutathione transferase, isoenzyme 3-3, t13s mutant, transferase
Deposited on 1996-01-26, released 1996-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mu class glutathione s-transferase of isoenzyme 3-3
    Species: Rattus rattus [TaxId:10117]
    Gene: CDNA INSERT OF CLONE PGT33MX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04905 (0-216)
      • engineered (12)
    Domains in SCOPe 2.06: d6gsva1, d6gsva2
  • Chain 'B':
    Compound: mu class glutathione s-transferase of isoenzyme 3-3
    Species: Rattus rattus [TaxId:10117]
    Gene: CDNA INSERT OF CLONE PGT33MX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04905 (0-216)
      • engineered (12)
    Domains in SCOPe 2.06: d6gsvb1, d6gsvb2
  • Heterogens: SO4, GPS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gsvA (A:)
    pmilgywnvrglshpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqwsnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gsvB (B:)
    pmilgywnvrglshpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqwsnk