PDB entry 6gst

View 6gst on RCSB PDB site
Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Class: transferase
Keywords: glutathione transferase, isoenzyme 3-3, transferase
Deposited on 1996-01-26, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.149
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mu class glutathione s-transferase of isoenzyme 3-3
    Species: Rattus rattus [TaxId:10117]
    Gene: CDNA INSERT OF CLONE PGT33MX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gsta1, d6gsta2
  • Chain 'B':
    Compound: mu class glutathione s-transferase of isoenzyme 3-3
    Species: Rattus rattus [TaxId:10117]
    Gene: CDNA INSERT OF CLONE PGT33MX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gstb1, d6gstb2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gstA (A:)
    pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqwsnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gstB (B:)
    pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqwsnk