PDB entry 6gsp

View 6gsp on RCSB PDB site
Description: ribonuclease t1/3'-gmp, 15 weeks
Class: endoribonuclease
Keywords: hydrolase, endoribonuclease, ribonuclease, endonuclease
Deposited on 1997-12-09, released 1998-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.195
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease t1
  Species: Aspergillus oryzae [TaxId:5062]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
  Domains in SCOPe 2.06: d6gspa_
• Heterogens: CA, 3GP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6gspA (A:)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect