PDB entry 6gsf

View 6gsf on RCSB PDB site
Description: solution structure of lipase binding domain lid1 of foldase from pseudomonas aeruginosa
Deposited on 2018-06-14, released 2018-12-26
The last revision was dated 2020-03-18, with a file datestamp of 2020-03-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase chaperone
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: lifO, lipB, lipH, PA2863
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01725 (8-88)
      • expression tag (7)
      • engineered mutation (41)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gsfA (A:)
mghhhhhhlptsfrgtsvdgsfsvdasgnllitrdirnlfdaflsavgeeplqqsldrlr
ayiaaelqepargqalalmqqyidykkel

    Sequence, based on observed residues (ATOM records):
    >6gsfA (A:)
hlptsfrgtsvdgsfsvdasgnllitrdirnlfdaflsavgeeplqqsldrlrayiaael
qepargqalalmqqyidykkel