PDB entry 6gse

View 6gse on RCSB PDB site
Description: solution structure of the capsid domain from the activity-regulated cytoskeleton-associated protein, arc
Deposited on 2018-06-14, released 2019-05-22
The last revision was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: NMR;SAXS
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activity-regulated cytoskeleton-associated protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ARC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63053 (0-158)
      • conflict (3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gseA (A:)
spgldtqifedpreflshleeylrqvggseeywlsqiqnhmngpakkwwefkqgsvknwv
efkkeflqysegtlsreaiqreldlpqkqgepldqflwrkrdlyqtlyvdaeeeeiiqyv
vgtlqpkfkrflrhplpktleqliqrgmevqdgleqaae