PDB entry 6gs6

View 6gs6 on RCSB PDB site
Description: Cyclophilin A single mutant D66A in complex with an inhibitor.
Class: isomerase
Keywords: Cyclophilins, CypA, CypA mutant, inhibitor, PPIase, complex, isomerase
Deposited on 2018-06-13, released 2019-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 1.16 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIA, CYPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62937 (0-164)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d6gs6a_
  • Heterogens: EA4, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gs6A (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggaftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gs6A (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggaftggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktewldgk
    hvvfgkvkegmniveamerfgsrngktskkitiadcgqle