PDB entry 6grv

View 6grv on RCSB PDB site
Description: cadmium(ii) form of full-length metallothionein from pseudomonas fluorescens q2-87 (pflq2 mt)
Deposited on 2018-06-12, released 2018-09-19
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallothionein
    Species: Pseudomonas fluorescens Q2-87 [TaxId:1038922]
    Gene: PflQ2_2045
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CD

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6grvA (A:)
nelrcgcpdchckvdpervfnhdgeaycsqacaeqhpngepcpapdchcersgkvggrdi
tnnqldealeetfpasdpisp