PDB entry 6gro

View 6gro on RCSB PDB site
Description: Human CSNK1G3 bound to SB-223133
Class: transferase
Keywords: Kinase, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2018-06-12, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase I isoform gamma-3
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1G3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6M4
      • conflict (154)
    Domains in SCOPe 2.07: d6groa_
  • Heterogens: EDO, CL, F92, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6groA (A:)
    smgvlmvgpnfrvgkkigcgnfgelrlgknlytneyvaiklepmksrapqlhleyrfykq
    lgsgdgipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmey
    vhsknliyrdvkpenfligrpgnktqqvihiidfalakeyidpetkkhipyrehksltgt
    arymsinthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratp
    ievlcenfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlpt
    pvgavqqdpalssnreahqhrdkmqqsknq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6groA (A:)
    lmvgpnfrvgkkigcgnfgelrlgknlytneyvaiklepmksrapqlhleyrfykqlgsg
    dgipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmeyvhsk
    nliyrdvkpenfligrpgnktqqvihiidfalakeyidpetkkhipyrehksltgtarym
    sinthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratpievl
    cenfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkq