PDB entry 6grn

View 6grn on RCSB PDB site
Description: CELLOBIOHYDROLASE I (CEL7A) FROM Trichoderma reesei with S-dihydroxypropranolol in the active site
Class: hydrolase
Keywords: CELLULASE, Glyco_hydro_7, cellobiohydrolase, chiral selector, HYDROLASE
Deposited on 2018-06-11, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exoglucanase 1
    Species: TRICHODERMA REESEI [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6grna_
  • Heterogens: F9B, NAG, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6grnA (A:)
    esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
    cpdnetcaknccldgaayastygvttsgnslsigfvtqsaqknvgarlylmasdttyqef
    tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
    kfingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeiceg
    dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
    nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
    vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
    ikfgpigstgnpsg