PDB entry 6grj

View 6grj on RCSB PDB site
Description: structure of the ahlb pore of the tripartite alpha-pore forming toxin, ahl, from aeromonas hydrophila.
Deposited on 2018-06-11, released 2019-07-03
The last revision was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AhlB
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: A9R12_16795
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: AhlB
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: A9R12_16795
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: AhlB
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: A9R12_16795
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: AhlB
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: A9R12_16795
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: AhlB
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: A9R12_16795
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: AhlB
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: A9R12_16795
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: AhlB
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: A9R12_16795
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: AhlB
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: A9R12_16795
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: AhlB
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: A9R12_16795
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: AhlB
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: A9R12_16795
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MPD, PO4, CL, NA

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6grjA (A:)
    mtnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakg
    hadlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrl
    ssdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiag
    ivaggllviggafvtaigavadfvtagtstpvviggvammvagaggitagaivlhnslga
    rqdlyqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdl
    dkgitsgddirqlwltaadttvktvltdvttikaqiagvsplqvpqtdtianfvarlaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6grjA (A:)
    tnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakgh
    adlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrls
    sdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiagi
    vaggllviggafvtaigavadfvttstpvviggvammvagaggitagaivlhnslgarqd
    lyqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdldkg
    itsgddirqlwltaadttvktvltdvttikaqiagvsp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6grjB (B:)
    mtnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakg
    hadlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrl
    ssdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiag
    ivaggllviggafvtaigavadfvtagtstpvviggvammvagaggitagaivlhnslga
    rqdlyqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdl
    dkgitsgddirqlwltaadttvktvltdvttikaqiagvsplqvpqtdtianfvarlaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6grjB (B:)
    qasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakghadlylntiqpqiit
    nisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrlssdtrlvivnlnnnl
    itdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiagivaggllviggafvt
    aigavadfvtagtstpvviggvammvagaggitagaivlhnslgarqdlyqkrsslnsev
    liatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdldkgitsgddirqlwl
    taadttvktvltdvttikaqia
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6grjC (C:)
    mtnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakg
    hadlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrl
    ssdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiag
    ivaggllviggafvtaigavadfvtagtstpvviggvammvagaggitagaivlhnslga
    rqdlyqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdl
    dkgitsgddirqlwltaadttvktvltdvttikaqiagvsplqvpqtdtianfvarlaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6grjC (C:)
    tnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakgh
    adlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrls
    sdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiagi
    vaggllviggafvtaigavadfvttstpvviggvammvagaggitagaivlhnslgarqd
    lyqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdldkg
    itsgddirqlwltaadttvktvltdvttikaqiagvsp
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6grjD (D:)
    mtnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakg
    hadlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrl
    ssdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiag
    ivaggllviggafvtaigavadfvtagtstpvviggvammvagaggitagaivlhnslga
    rqdlyqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdl
    dkgitsgddirqlwltaadttvktvltdvttikaqiagvsplqvpqtdtianfvarlaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6grjD (D:)
    nqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakghadlylntiqpqii
    tnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrlssdtrlvivnlnnn
    litdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiagivaggllviggafv
    taigavadfvtstpvviggvammvagaggitagaivlhnslgarqdlyqkrsslnsevli
    atqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdldkgitsgddirqlwlta
    adttvktvltdvttikaqia
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6grjE (E:)
    mtnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakg
    hadlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrl
    ssdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiag
    ivaggllviggafvtaigavadfvtagtstpvviggvammvagaggitagaivlhnslga
    rqdlyqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdl
    dkgitsgddirqlwltaadttvktvltdvttikaqiagvsplqvpqtdtianfvarlaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6grjE (E:)
    tnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakgh
    adlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrls
    sdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiagi
    vaggllviggafvtaigavadfvgtstpvviggvammvagaggitagaivlhnslgarqd
    lyqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdldkg
    itsgddirqlwltaadttvktvltdvttikaqiagvsp
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6grjF (F:)
    mtnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakg
    hadlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrl
    ssdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiag
    ivaggllviggafvtaigavadfvtagtstpvviggvammvagaggitagaivlhnslga
    rqdlyqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdl
    dkgitsgddirqlwltaadttvktvltdvttikaqiagvsplqvpqtdtianfvarlaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6grjF (F:)
    asqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakghadlylntiqpqiitn
    isnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrlssdtrlvivnlnnnli
    tdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiagivaggllviggafvta
    igavadftstpvviggvammvagaggitagaivlhnslgarqdlyqkrsslnsevliatq
    igngykglqvqaqnavtaatqmsnawdsltsdlgslitdldkgitsgddirqlwltaadt
    tvktvltdvttikaqia
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6grjG (G:)
    mtnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakg
    hadlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrl
    ssdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiag
    ivaggllviggafvtaigavadfvtagtstpvviggvammvagaggitagaivlhnslga
    rqdlyqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdl
    dkgitsgddirqlwltaadttvktvltdvttikaqiagvsplqvpqtdtianfvarlaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6grjG (G:)
    tnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakgh
    adlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrls
    sdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiagi
    vaggllviggafvtaigavadfvttstpvviggvammvagaggitagaivlhnslgarqd
    lyqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdldkg
    itsgddirqlwltaadttvktvltdvttikaqiagvsp
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6grjH (H:)
    mtnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakg
    hadlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrl
    ssdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiag
    ivaggllviggafvtaigavadfvtagtstpvviggvammvagaggitagaivlhnslga
    rqdlyqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdl
    dkgitsgddirqlwltaadttvktvltdvttikaqiagvsplqvpqtdtianfvarlaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6grjH (H:)
    tnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakgh
    adlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrls
    sdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiagi
    vaggllviggafvtaigavadfvtstpvviggvammvagaggitagaivlhnslgarqdl
    yqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdldkgi
    tsgddirqlwltaadttvktvltdvttikaqiagvsp
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >6grjI (I:)
    mtnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakg
    hadlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrl
    ssdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiag
    ivaggllviggafvtaigavadfvtagtstpvviggvammvagaggitagaivlhnslga
    rqdlyqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdl
    dkgitsgddirqlwltaadttvktvltdvttikaqiagvsplqvpqtdtianfvarlaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6grjI (I:)
    qasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakghadlylntiqpqiit
    nisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrlssdtrlvivnlnnnl
    itdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiagivaggllviggafvt
    aigavastpvviggvammvagaggitagaivlhnslgarqdlyqkrsslnsevliatqig
    ngykglqvqaqnavtaatqmsnawdsltsdlgslitdldkgitsgddirqlwltaadttv
    ktvltdvttikaqia
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >6grjJ (J:)
    mtnattitmdqgmanqasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakg
    hadlylntiqpqiitnisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrl
    ssdtrlvivnlnnnlitdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiag
    ivaggllviggafvtaigavadfvtagtstpvviggvammvagaggitagaivlhnslga
    rqdlyqkrsslnsevliatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdl
    dkgitsgddirqlwltaadttvktvltdvttikaqiagvsplqvpqtdtianfvarlaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6grjJ (J:)
    qasqamqiqtycnsvkqqvpvdfsqfpnlkdnqtqinqgldlakghadlylntiqpqiit
    nisnisnyfalqnaipavlppgstkaqwlrqlsvikeqateyqrlssdtrlvivnlnnnl
    itdssnfqgivvnlnskvqgdngvlaqlngdidkvnaaidgaiagivaggllviggafvt
    aigavadfvtagtstpvviggvammvagaggitagaivlhnslgarqdlyqkrsslnsev
    liatqigngykglqvqaqnavtaatqmsnawdsltsdlgslitdldkgitsgddirqlwl
    taadttvktvltdvttikaqia