PDB entry 6gr8

View 6gr8 on RCSB PDB site
Description: Human AURKC INCENP complex bound to BRD-7880
Class: transferase
Keywords: Kinase, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2018-06-10, released 2019-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.7500000000000002 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase C
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKC, AIE2, AIK3, AIRK3, ARK3, STK13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQB9 (4-End)
      • expression tag (0-3)
      • conflict (104)
    Domains in SCOPe 2.08: d6gr8a1, d6gr8a2
  • Chain 'B':
    Compound: Inner centromere protein
    Species: Homo sapiens [TaxId:9606]
    Gene: INCENP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: F8Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gr8A (A:)
    gansrrltvddfeigrplgkgkfgnvylarlkeshfivalkvlfksqiekeglehqlrre
    ieiqahlqhpnilrlynyfhdarrvylileyaprgelykelqksdkldeqrtatiieela
    daltychdkkvihrdikpenlllgfrgevkiadfgwsvhtpslrrktmcgtldylppemi
    egrtydekvdlwcigvlcyellvgyppfesashsetyrrilkvdvrfplsmplgardlis
    rllryqplerlplaqilkhpwvqahsrrvlppca
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gr8A (A:)
    gansrrltvddfeigrplgkgkfgnvylarlkeshfivalkvlfksqiekeglehqlrre
    ieiqahlqhpnilrlynyfhdarrvylileyaprgelykelqksdkldeqrtatiieela
    daltychdkkvihrdikpenlllgfrgevkiadfgwsvhtpslrrktmcgtldylppemi
    egrtydekvdlwcigvlcyellvgyppfesashsetyrrilkvdvrfplsmplgardlis
    rllryqplerlplaqilkhpwvqahsrrvlpp
    

  • Chain 'B':
    No sequence available.