PDB entry 6gqw

View 6gqw on RCSB PDB site
Description: kras-169 q61h gppnhp + ch-1
Class: oncoprotein
Keywords: kras, oncoprotein
Deposited on 2018-06-08, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (3-169)
      • expression tag (0-2)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d6gqwa1, d6gqwa2
  • Chain 'B':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (4-170)
      • expression tag (0-3)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d6gqwb1, d6gqwb2
  • Chain 'C':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (4-170)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d6gqwc1, d6gqwc2
  • Chain 'D':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (4-170)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d6gqwd1, d6gqwd2
  • Chain 'E':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (4-170)
      • expression tag (0-3)
      • conflict (23)
    Domains in SCOPe 2.07: d6gqwe1, d6gqwe2
  • Chain 'F':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (4-170)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d6gqwf1, d6gqwf2
  • Heterogens: MG, GNP, F8T, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gqwA (A:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnk
    cdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gqwB (B:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgn
    kcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gqwB (B:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtaghesamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkc
    dlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gqwC (C:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgn
    kcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gqwC (C:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagsamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gqwD (D:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgn
    kcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gqwD (D:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydedsyrkqvvidgetclldildta
    grdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvd
    tkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6gqwE (E:)
    yfqgmteyklvvvgaggvgksalviqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgn
    kcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gqwE (E:)
    yfqgmteyklvvvgaggvgksalviqliqnhfvdeydpedsyrkqvvidgetclldildt
    agrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtv
    dtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6gqwF (F:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgn
    kcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gqwF (F:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptedsyrkqvvidgetclldild
    tagamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlps
    rtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk