PDB entry 6gqu

View 6gqu on RCSB PDB site
Description: Structure of human Heat shock protein 90-alpha N-terminal domain (Hsp90-NTD) variant K112R in complex with cAMP
Class: chaperone
Keywords: CHAPERONE, Hsp90, NTD, alpha, K112R, complex, cAMP
Deposited on 2018-06-08, released 2018-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.7200000000000002 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (20-End)
      • expression tag (14-19)
      • engineered mutation (131)
    Domains in SCOPe 2.08: d6gqua1, d6gqua2
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gquA (A:)
    mgsshhhhhhssglvprgshmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysn
    keiflrelisnssdaldkiryesltdpskldsgkelhinlipnkqdrtltivdtgigmtk
    adlinnlgtiarsgtkafmealqagadismigqfgvgfysaylvaekvtvitkhnddeqy
    awessaggsftvrtdtgepmgrgtkvilhlkedqteyleerrikeivkkhsqfigypitl
    fvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gquA (A:)
    vprgshmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssd
    aldkiryesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiarsg
    tkafmealqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrt
    dtgepmgrgtkvilhlkedqteyleerrikeivkkhsqfigypitlfveker