PDB entry 6gqt

View 6gqt on RCSB PDB site
Description: kras-169 q61h gppnhp + ppin-2
Class: oncoprotein
Keywords: kras, oncoprotein
Deposited on 2018-06-08, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (3-170)
      • expression tag (0-2)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d6gqta1, d6gqta2
  • Chain 'B':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (3-170)
      • expression tag (0-2)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d6gqtb1, d6gqtb2
  • Chain 'C':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6gqtc1, d6gqtc2
  • Chain 'D':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6gqtd1, d6gqtd2
  • Chain 'E':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6gqte1, d6gqte2
  • Chain 'F':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6gqtf1, d6gqtf2
  • Heterogens: GNP, MG, CIT, F8N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gqtA (A:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnk
    cdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gqtB (B:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnk
    cdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gqtC (C:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnk
    cdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gqtC (C:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydsyrkqvvidgetclldildtagmr
    dqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtk
    qaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gqtD (D:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnk
    cdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gqtD (D:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeedsyrkqvvidgetclldildtagam
    rdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdt
    kqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6gqtE (E:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnk
    cdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gqtE (E:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagmrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsr
    tvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6gqtF (F:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnk
    cdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gqtF (F:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdedsyrkqvvidgetclldildtagmrd
    qymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkq
    aqdlarsygipfietsaktrqgvddafytlvreirkhk