PDB entry 6gqn

View 6gqn on RCSB PDB site
Description: cell division regulator, s. pneumoniae gpsb, in complex with peptide fragment of penicillin binding protein pbp2a
Deposited on 2018-06-07, released 2019-01-23
The last revision was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell cycle protein gpsb
    Species: STREPTOCOCCUS PNEUMONIAE R6 [TaxId:171101]
    Gene: gpsB, spr0332
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DR57 (2-61)
      • expression tag (0-1)
  • Chain 'B':
    Compound: cell cycle protein gpsb
    Species: STREPTOCOCCUS PNEUMONIAE R6 [TaxId:171101]
    Gene: gpsB, spr0332
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DR57 (2-61)
      • expression tag (0-1)
  • Chain 'C':
    Compound: SpPBP2a
    Species: Streptococcus pneumoniae, synthetic [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GQN (0-13)
  • Chain 'G':
    Compound: SpPBP2a
    Species: Streptococcus pneumoniae, synthetic [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GQN (Start-13)
  • Heterogens: SO4, NI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gqnA (A:)
    gaiifsakdifeqefgrevrgynkvevdeflddvikdyetyaalvkslrqeiadlkeelt
    rk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6gqnB (B:)
    gaiifsakdifeqefgrevrgynkvevdeflddvikdyetyaalvkslrqeiadlkeelt
    rk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6gqnC (C:)
    tilrrsrsdrkkla
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6gqnG (G:)
    tilrrsrsdrkkla
    

    Sequence, based on observed residues (ATOM records):
    >6gqnG (G:)
    ilrrsrsdrkkla