PDB entry 6gqg

View 6gqg on RCSB PDB site
Description: Structure of GFPmut2 crystallized at pH 8.5
Class: fluorescent protein
Keywords: fluorescent protein, beta barrel, bioluminescence
Deposited on 2018-06-07, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (6-End)
      • chromophore (70)
      • engineered mutation (71)
      • engineered mutation (75)
    Domains in SCOPe 2.07: d6gqga_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gqgA (A:)
    gshigpmskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklp
    vpwptlvttfxlqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfeg
    dtlvnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsv
    qladhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdel
    yk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gqgA (A:)
    mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfxlqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
    ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
    qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit