PDB entry 6gqd

View 6gqd on RCSB PDB site
Description: Structure of human galactose-1-phosphate uridylyltransferase (GALT), with crystallization epitope mutations A21Y:A22T:T23P:R25L
Class: transferase
Keywords: crystal epitope, transferase, glucose-1-phosphate, uridine monophosphate, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2018-06-07, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galactose-1-phosphate uridylyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07902
      • conflict (21-23)
      • conflict (25)
      • conflict (314)
    Domains in SCOPe 2.07: d6gqda1, d6gqda2
  • Heterogens: ZN, EDO, H2U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gqdA (A:)
    smsrsgtdpqqrqqaseadaaytpflandhqhirynplqdewvlvsahrmkrpwqgqvep
    qllktvprhdplnplcpgairangevnpqydstflfdndfpalqpdapspgpsdhplfqa
    ksargvckvmcfhpwsdvtlplmsvpeiravvdawasvteelgaqypwvqifenkgammg
    csnphphcqvwassflpdiaqreersqqayksqhgepllmeysrqellrkerlvltsehw
    lvlvpfwatwpyqtlllprrhvrrlpeltpaerddlasimkklltkydnlfetsfpysmg
    whgaptgseaganwdhwqlhahyyppllrsatvrkfmvgyemlaqaqrdltpeqaaerlr
    alpevhyhlgqkdretatia
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gqdA (A:)
    ytpflandhqhirynplqdewvlvsahrmkrpwqgqllktvprhdplnplcpgairange
    vnpqydstflfdndfpalqpdapspgpsdhplfqaksargvckvmcfhpwsdvtlplmsv
    peiravvdawasvteelgaqypwvqifenkgammgcsnphphcqvwassflpdiaqreer
    sqqayksqhgepllmeysrqellrkerlvltsehwlvlvpfwatwpyqtlllprrhvrrl
    peltpaerddlasimkklltkydnlfetsfpysmgwhgaptgseaganwdhwqlhahyyp
    pllrsatvrkfmvgyemlaqaqrdltpeqaaerlralpevhyhl