PDB entry 6gq9

View 6gq9 on RCSB PDB site
Description: Solution structure of the hazel allergen Cor a 1.0401
Class: allergen
Keywords: PR-10 allergen, hydrophobic pocket, Bet v 1 homologue, ALLERGEN
Deposited on 2018-06-07, released 2019-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major allergen Cor a 1.0401
    Species: Corylus avellana [TaxId:13451]
    Gene: CORA1.0401
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6gq9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gq9A (A:)
    mgvfcyedeatsvipparlfksfvldadnlipkvapqhftsaenlegnggpgtikkitfa
    egnefkymkhkveeidhanfkycysiieggplghtlekisyeikmaaaphgggsilkits
    kyhtkgnasineeeikagkekaaglfkaveayllahpdayc