PDB entry 6gq8

View 6gq8 on RCSB PDB site
Description: superoxide reductase from nanoarchaeum equitans
Deposited on 2018-06-07, released 2018-06-20
The last revision was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neq011
    Species: Nanoarchaeum equitans Kin4-M [TaxId:228908]
    Gene: NEQ011
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: neq011
    Species: Nanoarchaeum equitans Kin4-M [TaxId:228908]
    Gene: NEQ011
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: neq011
    Species: Nanoarchaeum equitans Kin4-M [TaxId:228908]
    Gene: NEQ011
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: neq011
    Species: Nanoarchaeum equitans Kin4-M [TaxId:228908]
    Gene: NEQ011
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gq8A (A:)
mikteynpkhspiieiekegelykitievgkevkhpnepshhiqwvdlyfepegkepthi
ariefkahgeynnytepkaivyaklegkgkliaisyctlhglwktekel

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6gq8B (B:)
mikteynpkhspiieiekegelykitievgkevkhpnepshhiqwvdlyfepegkepthi
ariefkahgeynnytepkaivyaklegkgkliaisyctlhglwktekel

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6gq8C (C:)
mikteynpkhspiieiekegelykitievgkevkhpnepshhiqwvdlyfepegkepthi
ariefkahgeynnytepkaivyaklegkgkliaisyctlhglwktekel

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6gq8D (D:)
mikteynpkhspiieiekegelykitievgkevkhpnepshhiqwvdlyfepegkepthi
ariefkahgeynnytepkaivyaklegkgkliaisyctlhglwktekel