PDB entry 6gq4

View 6gq4 on RCSB PDB site
Description: neisseria gonorrhoeae adhesin complex protein
Deposited on 2018-06-07, released 2018-09-19
The last revision was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adhesin
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: BZG33_11025, BZG34_11065
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A222R8P4 (Start-102)
      • expression tag (103-106)
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gq4A (A:)
agtdnptvakktvsyvcqqgkkvkvtygfnkqglttyasavingkrvqmpinldksdnmd
tfygkeggyvlstgamdsksyrkqpimitapdnqivfkdcsprlehhhhhh

    Sequence, based on observed residues (ATOM records):
    >6gq4A (A:)
nptvakktvsyvcqqgkkvkvtygfnkqglttyasavingkrvqmpinldksdnmdtfyg
keggyvlstgamdsksyrkqpimitapdnqivfkdcsprlehh