PDB entry 6gpz

View 6gpz on RCSB PDB site
Description: cell division regulator gpsb in complex with peptide fragment of l. monocytogenes penicillin binding protein pbpa1
Deposited on 2018-06-07, released 2019-01-23
The last revision was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell cycle protein gpsb
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Gene: gpsB, ypsB, BSU22180
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CI74 (3-62)
      • expression tag (0-2)
      • engineered mutation (30)
  • Chain 'B':
    Compound: cell cycle protein gpsb
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Gene: gpsB, ypsB, BSU22180
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CI74 (3-End)
      • expression tag (0-2)
      • engineered mutation (30)
  • Chain 'E':
    Compound: LmPBPA1
    Species: Listeria monocytogenes, synthetic [TaxId:1639]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GPZ
  • Heterogens: ZN, IMD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gpzA (A:)
ghmkvklsakeilekefktgvrgykqedvdefldmiikdyetfhqeieelqqenlqlkkq
lee

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gpzB (B:)
ghmkvklsakeilekefktgvrgykqedvdefldmiikdyetfhqeieelqqenlqlkkq
lee

    Sequence, based on observed residues (ATOM records):
    >6gpzB (B:)
ghmkvklsakeilekefktgvrgykqedvdefldmiikdyetfhqeieelqqenlqlkkq
le

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6gpzE (E:)
madkpqtrsqyrnkq

    Sequence, based on observed residues (ATOM records):
    >6gpzE (E:)
trs