PDB entry 6gpv

View 6gpv on RCSB PDB site
Description: Crystal structure of blue-light irradiated miniSOG
Class: flavoprotein
Keywords: Singlet oxygen, fluorescent protein, FMN, protein oxidation, gamma-peroxotyrosine, oxidized histidine, n-formylkynurenin, FLAVOPROTEIN
Deposited on 2018-06-07, released 2019-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phototropin-2
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: PHOT2, CAV1, KIN7, NPL1, At5g58140, K21L19.6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P93025 (0-105)
    • conflict (0)
    • conflict (3)
    • conflict (7)
    • conflict (22)
    • conflict (39)
    • conflict (83)
    • microheterogeneity (84)
    • expression tag (106-108)
  Domains in SCOPe 2.08: d6gpva1, d6gpva2
• Heterogens: LUM, HOO, NFK, F7Q, FMN, MG, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6gpvA (A:)
  meksfvitdprlpdnpiifasdgflelteysreeilgrngrflqgpetdqatvqkirdai
  rdqreitvqlinytksgkkfxnllxlqpmrdqkgelqyfigvqldgefipnpllg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6gpvA (A:)
  meksfvitdprlpdnpiifasdgflelteysreeilgrngrflqgpetdqatvqkirdai
  rdqreitvqlinytksgkkfxnllxlqpmrdqkgelqyfigvqldgefi