PDB entry 6gpn

View 6gpn on RCSB PDB site
Description: Crystal Structure of the CsiD Glutarate Hydroxylase in complex with N-Oxalylglycine
Class: hydrolase
Keywords: jelly roll, glutarate hydroxylase, alpha-ketoglutarate-dependent, HYDROLASE
Deposited on 2018-06-06, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein CsiD
    Species: Escherichia coli H386 [TaxId:656397]
    Gene: csiD, ECVG_01093
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gpna_
  • Chain 'B':
    Compound: Protein CsiD
    Species: Escherichia coli H386 [TaxId:656397]
    Gene: csiD, ECVG_01093
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gpnb_
  • Heterogens: FE2, OGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gpnA (A:)
    mgsshhhhhhssglvprgshmnaltavqnnavdsgqdysgftltpsaqsprlleltfteq
    ttkqfleqvaewpvqaleyksflrfrvakilddlcanqlqplllktllnraegallinav
    gvddvkqademvklatavahligrsnfdamsgqyyarfvvknvdnsdsylrqphrvmelh
    ndgtyveeitdyvlmmkideqnmqggnslllhlddwehldnyfrhplarrpmrfaappsk
    nvskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdaietskgilsvpvpvg
    kfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyqthqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gpnA (A:)
    qdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddlc
    anqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyy
    arfvvknhrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehldnyfrhp
    larrpmrfaakdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdaietskgil
    svpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gpnB (B:)
    mgsshhhhhhssglvprgshmnaltavqnnavdsgqdysgftltpsaqsprlleltfteq
    ttkqfleqvaewpvqaleyksflrfrvakilddlcanqlqplllktllnraegallinav
    gvddvkqademvklatavahligrsnfdamsgqyyarfvvknvdnsdsylrqphrvmelh
    ndgtyveeitdyvlmmkideqnmqggnslllhlddwehldnyfrhplarrpmrfaappsk
    nvskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdaietskgilsvpvpvg
    kfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyqthqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gpnB (B:)
    qdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddlc
    anqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyy
    arfvvknhrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehldnyfrhp
    larrpmrfaappskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdaietsk
    gilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyq