PDB entry 6gpm

View 6gpm on RCSB PDB site
Description: crystal structure of domain 2 from tmargbp
Deposited on 2018-06-06, released 2018-08-15
The last revision was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amino acid ABC transporter, periplasmic amino acid-binding protein
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM_0593
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gpmA (A:)
gqvivvrkdsdfrpktyedlvgktvavqigttgdievskydgikvvrfdkftdaflelkr
gradavvldsatarafvaknpdlvissgvlss