PDB entry 6gpl

View 6gpl on RCSB PDB site
Description: Crystal structure of human GDP-D-mannose 4,6-dehydratase in complex with GDP-4k6d-Man
Class: lyase
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, Lyase
Deposited on 2018-06-06, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: GDP-mannose 4,6 dehydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: GMDS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gplb_
  • Chain 'C':
    Compound: GDP-mannose 4,6 dehydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: GMDS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gplc_
  • Chain 'D':
    Compound: GDP-mannose 4,6 dehydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: GMDS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gpld_
  • Chain 'E':
    Compound: GDP-mannose 4,6 dehydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: GMDS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gple_
  • Heterogens: BCN, F7E, NAP, EDO, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gplB (B:)
    smrnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlyknpqahiegnm
    klhygdltdstclvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavk
    tcglinsvkfyqastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlf
    avngilfnhesprrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamw
    lmlqndepedfviatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvd
    lkyyrptevdflqgdctkakqklnwkprvafdelvremvhadvelmrtnpna
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gplB (B:)
    rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlygnmklhygdltds
    tclvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktcglinsvkf
    yqastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfavngilfnhe
    sprrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlmlqndeped
    fviatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlkyyrptevd
    flqgdctkakqklnwkprvafdelvremvhadvelmrtnpna
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gplC (C:)
    smrnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlyknpqahiegnm
    klhygdltdstclvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavk
    tcglinsvkfyqastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlf
    avngilfnhesprrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamw
    lmlqndepedfviatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvd
    lkyyrptevdflqgdctkakqklnwkprvafdelvremvhadvelmrtnpna
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gplC (C:)
    rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlynmklhygdltdst
    clvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktcglinsvkfy
    qastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfavngilfnhes
    prrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlmlqndepedf
    viatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlkyyrptevdf
    lqgdctkakqklnwkprvafdelvremvhadvelmrtnpna
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gplD (D:)
    smrnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlyknpqahiegnm
    klhygdltdstclvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavk
    tcglinsvkfyqastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlf
    avngilfnhesprrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamw
    lmlqndepedfviatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvd
    lkyyrptevdflqgdctkakqklnwkprvafdelvremvhadvelmrtnpna
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gplD (D:)
    rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlynmklhygdltdst
    clvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktcglinsvkfy
    qastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfavngilfnhes
    prrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlmlqndepedf
    viatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlkyyrptevdf
    lqgdctkakqklnwkprvafdelvremvhadvelmrtnpna
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6gplE (E:)
    smrnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlyknpqahiegnm
    klhygdltdstclvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavk
    tcglinsvkfyqastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlf
    avngilfnhesprrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamw
    lmlqndepedfviatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvd
    lkyyrptevdflqgdctkakqklnwkprvafdelvremvhadvelmrtnpna
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gplE (E:)
    rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlynmklhygdltdst
    clvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktcglinsvkfy
    qastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfavngilfnhes
    prrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlmlqndepedf
    viatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlkyyrptevdf
    lqgdctkakqklnwkprvafdelvremvhadvelmrt