PDB entry 6gpd

View 6gpd on RCSB PDB site
Description: crystal structure of the ligand-free form of domain 1 from tmargbp
Deposited on 2018-06-05, released 2018-08-15
The last revision was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Amino acid ABC transporter, periplasmic amino acid-binding protein,Amino acid ABC transporter, periplasmic amino acid-binding protein
  Species: THERMOTOGA MARITIMA MSB8 [TaxId:243274]
  Gene: TM_0593
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WZ62 (0-95)
    • linker (96-100)
  • Uniprot Q9WZ62 (101-125)
• Chain 'B':
  Compound: Amino acid ABC transporter, periplasmic amino acid-binding protein,Amino acid ABC transporter, periplasmic amino acid-binding protein
  Species: THERMOTOGA MARITIMA MSB8 [TaxId:243274]
  Gene: TM_0593
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WZ62 (0-95)
    • linker (96-100)
  • Uniprot Q9WZ62 (101-125)
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6gpdA (A:)
  aideiksrgyllvglsadfppfefvdengnivgfdvdlakeiarrlgvelkivdmtfdgl
  ipslltkkidviisgmtiteerkkvvafsdpyfdaggggsgeqygiavrkedtdllefin
  svlrel
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6gpdB (B:)
  aideiksrgyllvglsadfppfefvdengnivgfdvdlakeiarrlgvelkivdmtfdgl
  ipslltkkidviisgmtiteerkkvvafsdpyfdaggggsgeqygiavrkedtdllefin
  svlrel