PDB entry 6gpc

View 6gpc on RCSB PDB site
Description: crystal structure of the arginine-bound form of domain 1 from tmargbp
Deposited on 2018-06-05, released 2018-08-15
The last revision was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Amino acid ABC transporter, periplasmic amino acid-binding protein,Amino acid ABC transporter, periplasmic amino acid-binding protein
  Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
  Gene: TM_0593
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WZ62 (0-95)
    • linker (96-100)
  • Uniprot Q9WZ62 (101-125)
• Chain 'B':
  Compound: Amino acid ABC transporter, periplasmic amino acid-binding protein,Amino acid ABC transporter, periplasmic amino acid-binding protein
  Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
  Gene: TM_0593
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WZ62 (0-95)
    • linker (96-100)
  • Uniprot Q9WZ62 (101-125)
• Heterogens: ARG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6gpcA (A:)
  aideiksrgyllvglsadfppfefvdengnivgfdvdlakeiarrlgvelkivdmtfdgl
  ipslltkkidviisgmtiteerkkvvafsdpyfdaggggsgeqygiavrkedtdllefin
  svlrel
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6gpcB (B:)
  aideiksrgyllvglsadfppfefvdengnivgfdvdlakeiarrlgvelkivdmtfdgl
  ipslltkkidviisgmtiteerkkvvafsdpyfdaggggsgeqygiavrkedtdllefin
  svlrel