PDB entry 6gpc
View 6gpc on RCSB PDB site
Description: crystal structure of the arginine-bound form of domain 1 from tmargbp
Deposited on
2018-06-05, released
2018-08-15
The last revision was dated
2018-08-15, with a file datestamp of
2018-08-10.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Amino acid ABC transporter, periplasmic amino acid-binding protein,Amino acid ABC transporter, periplasmic amino acid-binding protein
Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
Gene: TM_0593
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Amino acid ABC transporter, periplasmic amino acid-binding protein,Amino acid ABC transporter, periplasmic amino acid-binding protein
Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
Gene: TM_0593
Database cross-references and differences (RAF-indexed):
- Heterogens: ARG, HOH
PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.
- Chain 'A':
Sequence; same for both SEQRES and ATOM records:
>6gpcA (A:)
aideiksrgyllvglsadfppfefvdengnivgfdvdlakeiarrlgvelkivdmtfdgl
ipslltkkidviisgmtiteerkkvvafsdpyfdaggggsgeqygiavrkedtdllefin
svlrel
- Chain 'B':
Sequence; same for both SEQRES and ATOM records:
>6gpcB (B:)
aideiksrgyllvglsadfppfefvdengnivgfdvdlakeiarrlgvelkivdmtfdgl
ipslltkkidviisgmtiteerkkvvafsdpyfdaggggsgeqygiavrkedtdllefin
svlrel