PDB entry 6gp7

View 6gp7 on RCSB PDB site
Description: cell division regulator, b. subtilis gpsb, in complex with peptide fragment of penicillin binding protein pbp1a
Deposited on 2018-06-05, released 2019-01-23
The last revision was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell cycle protein gpsb
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Gene: gpsB, ypsB, BSU22180
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: cell cycle protein gpsb
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Gene: gpsB, ypsB, BSU22180
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: pbp1a
    Species: Bacillus subtilis subsp. subtilis str. 168, synthetic [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GP7
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gp7A (A:)
ghmkvklsakeilekefktgvrgykqedvdkfldmiikdyetfhqeieelqqenlqlkkq
lee

    Sequence, based on observed residues (ATOM records):
    >6gp7A (A:)
kvklsakeilekefktgvrgykqedvdkfldmiikdyetfhqeieelqqenlqlkkql

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gp7B (B:)
ghmkvklsakeilekefktgvrgykqedvdkfldmiikdyetfhqeieelqqenlqlkkq
lee

    Sequence, based on observed residues (ATOM records):
    >6gp7B (B:)
kvklsakeilekefktgvrgykqedvdkfldmiikdyetfhqeieelqqenlqlkkqle

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6gp7D (D:)
msdqfnsrearrkansk

    Sequence, based on observed residues (ATOM records):
    >6gp7D (D:)
fnsrearrkan