PDB entry 6gp0

View 6gp0 on RCSB PDB site
Description: Structure of mEos4b in the red fluorescent state
Class: fluorescent protein
Keywords: Fluorescent protein
Deposited on 2018-06-04, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green to red photoconvertible GFP-like protein EosFP
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (33-End)
      • expression tag (28-32)
      • conflict (41)
      • conflict (43)
      • conflict (66)
      • conflict (71)
      • microheterogeneity (93)
      • chromophore (94)
      • conflict (102-103)
      • conflict (107)
      • conflict (135)
      • conflict (154)
      • conflict (156)
      • conflict (191)
      • conflict (222)
      • conflict (228)
    Domains in SCOPe 2.07: d6gp0a1, d6gp0a2
  • Heterogens: IEY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gp0A (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsaikpdmriklrmegnvnghhfvidg
    dgtgkpyegkqtmdlevkeggplpfafdilttafxhygnrvfvkypdniqdyfkqsfpkg
    yswersltfedggicnarnditmegdtfynkvrfygtnfpangpvmqkktlkwepstekm
    yvrdgvltgdiemalllegnahyrcdfrttykakekgvklpgahfvdhaieilshdkdyn
    kvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gp0A (A:)
    ddkdpmsaikpdmriklrmegnvnghhfvidgdgtgkpyegkqtmdlevkeggplpfafd
    ilttafxhygnrvfvkypdniqdyfkqsfpkgyswersltfedggicnarnditmegdtf
    ynkvrfygtnfpangpvmqkktlkwepstekmyvrdgvltgdiemalllegnahyrcdfr
    ttykakekgvklpgahfvdhaieilshdkdynkvklyehavahsg