PDB entry 6goy

View 6goy on RCSB PDB site
Description: Structure of mEos4b in the green fluorescent state
Class: fluorescent protein
Keywords: Fluorescent protein
Deposited on 2018-06-04, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green to red photoconvertible GFP-like protein EosFP
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (33-End)
      • expression tag (28-32)
      • conflict (41)
      • conflict (43)
      • conflict (66)
      • conflict (71)
      • chromophore (96)
      • conflict (101-102)
      • conflict (106)
      • conflict (134)
      • conflict (153)
      • conflict (155)
      • conflict (190)
      • conflict (221)
      • conflict (227)
    Domains in SCOPe 2.07: d6goya1, d6goya2
  • Heterogens: CR8, PEG, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6goyA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsaikpdmriklrmegnvnghhfvidg
    dgtgkpyegkqtmdlevkeggplpfafdilttafhygnrvfvkypdniqdyfkqsfpkgy
    swersltfedggicnarnditmegdtfynkvrfygtnfpangpvmqkktlkwepstekmy
    vrdgvltgdiemalllegnahyrcdfrttykakekgvklpgahfvdhaieilshdkdynk
    vklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6goyA (A:)
    ddkdpmsaikpdmriklrmegnvnghhfvidgdgtgkpyegkqtmdlevkeggplpfafd
    ilttafhygnrvfvkypdniqdyfkqsfpkgyswersltfedggicnarnditmegdtfy
    nkvrfygtnfpangpvmqkktlkwepstekmyvrdgvltgdiemalllegnahyrcdfrt
    tykakekgvklpgahfvdhaieilshdkdynkvklyehavahs