PDB entry 6gow

View 6gow on RCSB PDB site
Description: Crystal structure of the flagellin-FliS complex from Bacillus subtilis crystallized in spacegroup P22121
Class: chaperone
Keywords: flagellum, type-3-secretion, chaperone
Deposited on 2018-06-04, released 2018-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Flagellin
    Species: Bacillus subtilis [TaxId:1423]
    Gene: B4417_3365
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Flagellar secretion chaperone FliS
    Species: Bacillus subtilis [TaxId:1423]
    Gene: B4417_3362, SC09_contig4orf00739
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6gowe_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >6gowE (E:)
maiqnpytayqqnsvntatpgeltlmlyngclkfirlaaqaienddmerknenlikaqni
iqelnftlnrnielsasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqaiq
serkdrhgsggia

    Sequence, based on observed residues (ATOM records): (download) 
    >6gowE (E:)
nsvntatpgeltlmlyngclkfirlaaqaienddmerknenlikaqniiqelnftlnrni
elsasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqaiqse