PDB entry 6goo

View 6goo on RCSB PDB site
Description: Crystal Structure Of Sea Bream Transthyretin in complex with Perfluorooctanoic acid (PFOA). Crystallized in AmSO4
Class: transport protein
Keywords: transthyretin, transport protein, thyroxine disrupting chemicals, TDCs, Perfluorooctanoic acid, PFOA
Deposited on 2018-06-01, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Sparus aurata [TaxId:8175]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gooa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Sparus aurata [TaxId:8175]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6goob_
  • Heterogens: 8PF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gooA (A:)
    gamaptptdkhggsdtrcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdat
    geihnliteqqfpagvyrvefdtkaywtnqgstpfhevaevvfdahpeghrhytlallls
    pfsytttavvssvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gooA (A:)
    cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
    rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gooB (B:)
    gamaptptdkhggsdtrcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdat
    geihnliteqqfpagvyrvefdtkaywtnqgstpfhevaevvfdahpeghrhytlallls
    pfsytttavvssvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gooB (B:)
    cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
    rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvs