PDB entry 6gol

View 6gol on RCSB PDB site
Description: three dimensional structure of a novel influenza hemagglutinin tri- stalk protein
Deposited on 2018-06-01, released 2018-10-10
The last revision was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin tri-stalk
    Species: Influenza A virus (A/California/VRDL69/2009(H1N1)) [TaxId:705461]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6golA (A:)
mntqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknl
yekvrsqlknna

    Sequence, based on observed residues (ATOM records):
    >6golA (A:)
ftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyekv
rsqlk