PDB entry 6gog

View 6gog on RCSB PDB site
Description: kras-169 q61h gppnhp
Class: oncoprotein
Keywords: kras, oncoprotein
Deposited on 2018-06-01, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (4-End)
      • expression tag (1-3)
      • engineered mutation (64)
      • conflict (154)
      • conflict (156)
      • conflict (168-170)
    Domains in SCOPe 2.07: d6goga1, d6goga2
  • Chain 'B':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (4-172)
      • expression tag (0-3)
      • engineered mutation (64)
      • conflict (154)
      • conflict (156)
      • conflict (168-171)
    Domains in SCOPe 2.07: d6gogb1, d6gogb2
  • Chain 'C':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (4-End)
      • expression tag (0-3)
      • engineered mutation (64)
      • conflict (154)
      • conflict (156)
      • conflict (168-171)
    Domains in SCOPe 2.07: d6gogc1, d6gogc2
  • Chain 'D':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (4-End)
      • expression tag (0-3)
      • engineered mutation (64)
      • conflict (154)
      • conflict (156)
      • conflict (168-170)
    Domains in SCOPe 2.07: d6gogd1, d6gogd2
  • Chain 'E':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (4-End)
      • expression tag (0-3)
      • engineered mutation (64)
      • conflict (154)
      • conflict (156)
      • conflict (168-171)
    Domains in SCOPe 2.07: d6goge1, d6goge2
  • Chain 'F':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (4-End)
      • expression tag (0-3)
      • engineered mutation (64)
      • conflict (154)
      • conflict (156)
      • conflict (168-171)
    Domains in SCOPe 2.07: d6gogf1, d6gogf2
  • Heterogens: GNP, MG, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gogA (A:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgn
    kcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gogA (A:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnk
    cdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gogB (B:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgn
    kcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gogC (C:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgn
    kcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gogC (C:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgn
    kcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gogD (D:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgn
    kcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gogD (D:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtaghsamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6gogE (E:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgn
    kcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gogE (E:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnk
    cdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6gogF (F:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgn
    kcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gogF (F:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgn
    kcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke