PDB entry 6gof

View 6gof on RCSB PDB site
Description: KRAS full length G12D GPPNHP
Class: oncoprotein
Keywords: KRAS full lenght, ONCOPROTEIN
Deposited on 2018-06-01, released 2019-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-171)
      • expression tag (0)
      • engineered mutation (11)
    Domains in SCOPe 2.08: d6gofa1, d6gofa2
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6gofA (A:)
steyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkekmsk