PDB entry 6goe

View 6goe on RCSB PDB site
Description: KRAS full length G12V GPPNHP
Class: oncoprotein
Keywords: KRAS full lenght, ONCOPROTEIN
Deposited on 2018-06-01, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (2-171)
      • expression tag (0-1)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d6goea1, d6goea2
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6goeA (A:)
    gsteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkekms
    

    Sequence, based on observed residues (ATOM records): (download)
    >6goeA (A:)
    gsteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqmrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrt
    vdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkekms