PDB entry 6go9

View 6go9 on RCSB PDB site
Description: Structure of GFPmut2 crystallized at pH 6 and transferred to pH 7
Class: fluorescent protein
Keywords: beta barrel, bioluminescence, FLUORESCENT PROTEIN
Deposited on 2018-06-01, released 2018-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (6-End)
      • expression tag (4-5)
      • chromophore (70)
      • engineered mutation (71)
      • engineered mutation (75)
    Domains in SCOPe 2.08: d6go9a1, d6go9a2
  • Heterogens: MPD, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6go9A (A:)
    gshigpmskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklp
    vpwptlvttfxlqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfeg
    dtlvnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsv
    qladhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdel
    yk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6go9A (A:)
    gpmskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwp
    tlvttfxlqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgm