PDB entry 6go2

View 6go2 on RCSB PDB site
Description: Carboxypeptidase T with N-sulfamoyl-L-Leucine
Class: hydrolase
Keywords: peptidase, hydrolase
Deposited on 2018-06-01, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase t
    Species: Thermoactinomyces vulgaris [TaxId:2026]
    Gene: cpt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6go2a_
  • Heterogens: ZN, CA, SO4, LU0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6go2A (A:)
    dfpsydsgyhnynemvnkintvasnypnivkkfsigksyegrelwavkisdnvgtdenep
    evlytalhharehltvemalytldlftqnynldsritnlvnnreiyivfninpdggeydi
    ssgsykswrknrqpnsgssyvgtdlnrnygykwgccggssgspssetyrgrsafsapeta
    amrdfinsrvvggkqqiktlitfhtyselilypygytytdvpsdmtqddfnvfktmantm
    aqtngytpqqasdlyitdgdmtdwaygqhkifaftfemyptsynpgfyppdevigretsr
    nkeavlyvaekadcpysvigksc