PDB entry 6gny

View 6gny on RCSB PDB site
Description: crystal structure of the majin-terb2 heterotetrameric complex
Deposited on 2018-06-01, released 2018-12-12
The last revision was dated 2020-04-22, with a file datestamp of 2020-04-17.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Membrane-anchored junction protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MAJIN, C11orf85
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Telomere repeats-binding bouquet formation protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TERB2, C15orf43
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Membrane-anchored junction protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MAJIN, C11orf85
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3KP22 (2-107)
      • expression tag (1)
  • Chain 'D':
    Compound: Telomere repeats-binding bouquet formation protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TERB2, C15orf43
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gnyA (A:)
    gsmslkpftypfpetrflhagpnvykfkirygksirgeeienkevitqeledsvrvvlgn
    ldnlqpfatehfivfpykskwervshlkfkhgeiilipypfvftlyve
    

    Sequence, based on observed residues (ATOM records):
    >6gnyA (A:)
    slkpftypfpetrflhagpnvykfkirygksirgeeienkevitqeledsvrvvlgnldn
    lqpfatehfivfpykskwervshlkfkhgeiilipypfvftlyve
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gnyB (B:)
    gsmpvnnmvtgyisidamkkflgelhdfipgtsgylayhvqne
    

    Sequence, based on observed residues (ATOM records):
    >6gnyB (B:)
    gyisidamkkflgelhdfipgtsgylayhv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6gnyC (C:)
    gsmslkpftypfpetrflhagpnvykfkirygksirgeeienkevitqeledsvrvvlgn
    ldnlqpfatehfivfpykskwervshlkfkhgeiilipypfvftlyve
    

    Sequence, based on observed residues (ATOM records):
    >6gnyC (C:)
    smslkpftypfpetrflhagpnvykfkirygksirgeeienkevitqeledsvrvvlgnl
    dnlqpfatehfivfpykskwervshlkfkhgeiilipypfvftlyve
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6gnyD (D:)
    gsmpvnnmvtgyisidamkkflgelhdfipgtsgylayhvqne
    

    Sequence, based on observed residues (ATOM records):
    >6gnyD (D:)
    gyisidamkkflgelhdfipgtsgylayhvq