PDB entry 6gnw

View 6gnw on RCSB PDB site
Description: Crystal Structure Of Sea Bream Transthyretin in complex with 2,4,5-trichlorophenoxyacetic acid (2,4,5-T)
Class: transport protein
Keywords: transthyretin, transport protein, thyroxine disrupting chemicals, TDCs, 2, 4, 5-trichlorophenoxyacetic acid, 5-T
Deposited on 2018-05-31, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Sparus aurata [TaxId:8175]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gnwa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Sparus aurata [TaxId:8175]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gnwb_
  • Chain 'C':
    Compound: Transthyretin
    Species: Sparus aurata [TaxId:8175]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gnwc_
  • Chain 'D':
    Compound: Transthyretin
    Species: Sparus aurata [TaxId:8175]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gnwd_
  • Heterogens: F52, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gnwA (A:)
    gamaptptdkhggsdtrcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdat
    geihnliteqqfpagvyrvefdtkaywtnqgstpfhevaevvfdahpeghrhytlallls
    pfsytttavvssvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gnwA (A:)
    cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
    rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gnwB (B:)
    gamaptptdkhggsdtrcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdat
    geihnliteqqfpagvyrvefdtkaywtnqgstpfhevaevvfdahpeghrhytlallls
    pfsytttavvssvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gnwB (B:)
    cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
    rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvssv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gnwC (C:)
    gamaptptdkhggsdtrcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdat
    geihnliteqqfpagvyrvefdtkaywtnqgstpfhevaevvfdahpeghrhytlallls
    pfsytttavvssvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gnwC (C:)
    cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
    rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gnwD (D:)
    gamaptptdkhggsdtrcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdat
    geihnliteqqfpagvyrvefdtkaywtnqgstpfhevaevvfdahpeghrhytlallls
    pfsytttavvssvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gnwD (D:)
    cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
    rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvss