SCOPe 2.08: Structural Classification of Proteins

PDB entry 6gnq

View 6gnq on RCSB PDB site
Description: monoclinic crystalline form of human insulin, complexed with meta- cresol
Deposited on 2018-05-31, released 2019-06-12
The last revision was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-20)
Chain 'B':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-29)
Chain 'C':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-20)
Chain 'D':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-29)
Chain 'E':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-20)
Chain 'F':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308
Chain 'G':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-20)
Chain 'H':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-End)
Chain 'I':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-20)
Chain 'J':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (Start-29)
Chain 'K':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-20)
Chain 'L':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-End)
Chain 'M':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-20)
Chain 'N':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308
Chain 'O':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-20)
Chain 'P':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308
Chain 'Q':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-20)
Chain 'R':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308
Chain 'S':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-20)
Chain 'T':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308
Chain 'U':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-20)
Chain 'V':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308
Chain 'W':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308 (0-20)
Chain 'X':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Gene: INS
Database cross-references and differences (RAF-indexed):
- Uniprot P01308
Heterogens: CRS, EDO, ZN, IS8, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

Chain 'A':
Sequence; same for both SEQRES and ATOM records:
```
>6gnqA (A:)
giveqcctsicslyqlenycn
```
Chain 'B':
Sequence; same for both SEQRES and ATOM records:
```
>6gnqB (B:)
fvnqhlcgshlvealylvcgergffytpkt
```
Chain 'C':
Sequence; same for both SEQRES and ATOM records:
```
>6gnqC (C:)
giveqcctsicslyqlenycn
```
Chain 'D':
Sequence; same for both SEQRES and ATOM records:
```
>6gnqD (D:)
fvnqhlcgshlvealylvcgergffytpkt
```
Chain 'E':
Sequence; same for both SEQRES and ATOM records:
```
>6gnqE (E:)
giveqcctsicslyqlenycn
```
Chain 'F':
Sequence, based on SEQRES records:
```
>6gnqF (F:)
fvnqhlcgshlvealylvcgergffytpkt
```
Sequence, based on observed residues (ATOM records):
```
>6gnqF (F:)
vnqhlcgshlvealylvcgergffytpk
```
Chain 'G':
Sequence; same for both SEQRES and ATOM records:
```
>6gnqG (G:)
giveqcctsicslyqlenycn
```
Chain 'H':
Sequence, based on SEQRES records:
```
>6gnqH (H:)
fvnqhlcgshlvealylvcgergffytpkt
```
Sequence, based on observed residues (ATOM records):
```
>6gnqH (H:)
fvnqhlcgshlvealylvcgergffytpk
```
Chain 'I':
Sequence; same for both SEQRES and ATOM records:
```
>6gnqI (I:)
giveqcctsicslyqlenycn
```
Chain 'J':
Sequence, based on SEQRES records:
```
>6gnqJ (J:)
fvnqhlcgshlvealylvcgergffytpkt
```
Sequence, based on observed residues (ATOM records):
```
>6gnqJ (J:)
nqhlcgshlvealylvcgergffytpkt
```
Chain 'K':
Sequence; same for both SEQRES and ATOM records:
```
>6gnqK (K:)
giveqcctsicslyqlenycn
```
Chain 'L':
Sequence, based on SEQRES records:
```
>6gnqL (L:)
fvnqhlcgshlvealylvcgergffytpkt
```
Sequence, based on observed residues (ATOM records):
```
>6gnqL (L:)
fvnqhlcgshlvealylvcgergffytpk
```
Chain 'M':
Sequence; same for both SEQRES and ATOM records:
```
>6gnqM (M:)
giveqcctsicslyqlenycn
```
Chain 'N':
Sequence, based on SEQRES records:
```
>6gnqN (N:)
fvnqhlcgshlvealylvcgergffytpkt
```
Sequence, based on observed residues (ATOM records):
```
>6gnqN (N:)
vnqhlcgshlvealylvcgergffytp
```
Chain 'O':
Sequence; same for both SEQRES and ATOM records:
```
>6gnqO (O:)
giveqcctsicslyqlenycn
```
Chain 'P':
Sequence, based on SEQRES records:
```
>6gnqP (P:)
fvnqhlcgshlvealylvcgergffytpkt
```
Sequence, based on observed residues (ATOM records):
```
>6gnqP (P:)
vnqhlcgshlvealylvcgergffyt
```
Chain 'Q':
Sequence; same for both SEQRES and ATOM records:
```
>6gnqQ (Q:)
giveqcctsicslyqlenycn
```
Chain 'R':
Sequence, based on SEQRES records:
```
>6gnqR (R:)
fvnqhlcgshlvealylvcgergffytpkt
```
Sequence, based on observed residues (ATOM records):
```
>6gnqR (R:)
vnqhlcgshlvealylvcgergffytp
```
Chain 'S':
Sequence; same for both SEQRES and ATOM records:
```
>6gnqS (S:)
giveqcctsicslyqlenycn
```
Chain 'T':
Sequence, based on SEQRES records:
```
>6gnqT (T:)
fvnqhlcgshlvealylvcgergffytpkt
```
Sequence, based on observed residues (ATOM records):
```
>6gnqT (T:)
vnqhlcgshlvealylvcgergffytpk
```
Chain 'U':
Sequence; same for both SEQRES and ATOM records:
```
>6gnqU (U:)
giveqcctsicslyqlenycn
```
Chain 'V':
Sequence, based on SEQRES records:
```
>6gnqV (V:)
fvnqhlcgshlvealylvcgergffytpkt
```
Sequence, based on observed residues (ATOM records):
```
>6gnqV (V:)
nqhlcgshlvealylvcgergffytpk
```
Chain 'W':
Sequence; same for both SEQRES and ATOM records:
```
>6gnqW (W:)
giveqcctsicslyqlenycn
```
Chain 'X':
Sequence, based on SEQRES records:
```
>6gnqX (X:)
fvnqhlcgshlvealylvcgergffytpkt
```
Sequence, based on observed residues (ATOM records):
```
>6gnqX (X:)
vnqhlcgshlvealylvcgergffytp
```