PDB entry 6gnk

View 6gnk on RCSB PDB site
Description: Exoenzyme S from Pseudomonas aeruginosa in complex with human 14-3-3 protein beta, trimeric crystal form bound to Carba-NAD
Class: toxin
Keywords: exos, pseudomonas aeruginosa, ADP-ribosylation, nad, toxin
Deposited on 2018-05-31, released 2018-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein beta/alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: Ywhab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6gnka_
  • Chain 'B':
    Compound: 14-3-3 protein beta/alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: Ywhab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6gnkb_
  • Chain 'C':
    Compound: exoenzyme s
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: EXOS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93SQ1 (23-End)
      • expression tag (22)
      • engineered mutation (169)
      • engineered mutation (171)
  • Heterogens: CNA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gnkA (A:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfy
    lkmkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsenenlyfq
    sle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gnkA (A:)
    mdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrsswr
    vissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfylk
    mkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gnkB (B:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfy
    lkmkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsenenlyfq
    sle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gnkB (B:)
    mdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrsswr
    vissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfylk
    mkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwts
    

  • Chain 'C':
    No sequence available.