PDB entry 6gn9

View 6gn9 on RCSB PDB site
Description: Crystal structure of a thioredoxin from Clostridium acetobutylicum at 1.75 A resolution
Class: oxidoreductase
Keywords: thioredoxin, OXIDOREDUCTASE
Deposited on 2018-05-30, released 2018-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Clostridium acetobutylicum ATCC 824 [TaxId:272562]
    Gene: CA_C3083
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6gn9a_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6gn9A (A:)
gshmvkeinesifdeeiktsgepvivdfwapwcgpckmlgpiidelsedldgkakftkvn
vdenpgiaskfgiasiptvmifkdgnpvetlvgfrpkqsitasiekhm

    Sequence, based on observed residues (ATOM records): (download) 
    >6gn9A (A:)
mvkeinesifdeeiktepvivdfwapwcgpckmlgpiidelsedldgkakftkvnvdenp
giaskfgiasiptvmifkdgnpvetlvgfrpkqsitasiekh