PDB entry 6gn1

View 6gn1 on RCSB PDB site
Description: Crystal Structure of Glycogen synthase kinase-3 beta (GSK3B) in Complex with PIK-75
Class: transferase
Keywords: Glycogen synthase kinase-3 beta, PIK-75, halogen bond, inhibitor, TRANSFERASE
Deposited on 2018-05-29, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gn1a_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gn1b_
  • Heterogens: F4N, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gn1A (A:)
    gkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaik
    kvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarh
    ysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsak
    qlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdq
    lveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytp
    tarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq
    aaastptn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gn1A (A:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
    relqimrkldhcnivrlryffyssevylnlvldyvpetvyrvarhysrakqtlpviyvkl
    ymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsr
    yyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreq
    iremnpnytepqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdel
    rdpnvklpngrdtpalfnfttqelssnpplatilipphar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gn1B (B:)
    gkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaik
    kvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarh
    ysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsak
    qlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdq
    lveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytp
    tarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq
    aaastptn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gn1B (B:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
    relqimrkldhcnivrlryffyssevylnlvldyvpetvyrvarhysrakqtlpviyvkl
    ymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsr
    yyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreq
    iremnpnytepqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdel
    rdpnvklpngrdtpalfnfttqelssnpplatilipphar