PDB entry 6gmt

View 6gmt on RCSB PDB site
Description: mamm ctd - cadmium form
Deposited on 2018-05-28, released 2019-06-19
The last revision was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Magnetosome protein MamM
    Species: Magnetospirillum gryphiswaldense [TaxId:55518]
    Gene: mamM, mgI491, MGR_4095
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NE57 (4-End)
      • expression tag (2-3)
  • Heterogens: SO4, CD, BME, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gmtA (A:)
gshmeavqnriveaaervpgvrgvihlraryvgqdiwadmiigvdpentveqaheiceav
qaavcgkirrieslhvsaeareigdttkpsfsdqplsfdevmlskvdn

    Sequence, based on observed residues (ATOM records):
    >6gmtA (A:)
hmeavqnriveaaervpgvrgvihlraryvgqdiwadmiigvdpentveqaheiceavqa
avcgkirrieslhvsaeare