PDB entry 6gms

View 6gms on RCSB PDB site
Description: solution nmr structure of the major type iv pilin ppdd from enterohemorrhagic escherichia coli (ehec)
Deposited on 2018-05-28, released 2019-05-15
The last revision was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prepilin peptidase-dependent protein D
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: ECs0112
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8X974 (2-116)
      • initiating methionine (0)
      • expression tag (1)
      • expression tag (117-131)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gmsA (A:)
    menylrkaaltdmlqtfvpyrtavelcalehggldtcdggsngipsptttryvsamsvak
    gvvsltgqeslnglsvvmtpgwdnangvtgwarncniqsdsalqqacedvfrfddanlvp
    rgsglehhhhhh