PDB entry 6gmp

View 6gmp on RCSB PDB site
Description: crystal structure of the ppiase domain of tbpar42
Class: isomerase
Keywords: PPIASE, Isomerase
Deposited on 2018-05-28, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parvulin 42
    Species: Trypanosoma brucei brucei (strain 927/4 GUTat10.1) [TaxId:185431]
    Gene: Tb927.7.2480
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gmpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gmpA (A:)
    gppterhfyhvlvkhkdvrrpsslaprnkgekitrsradainlaqailaqhkerktwsld
    efvqvvrdfsecgsakrdgdlgmvesgtytegfdtvafslksgevsapvetelgvhliyr
    ve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gmpA (A:)
    erhfyhvlvkhkdvrrpsslaprnkgekitrsradainlaqailaqhkerktwsldefvq
    vvrdfsecgsakrdgdlgmvesgtytegfdtvafslksgevsapvetelgvhliyrve